| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDASLTPLDELQWRSPEWIQAFGLRTDNVLEYFAQSPFFDRSSNNQVLKMQSQFNENLHTRTDLHKELQNMKGIEFVISFSREPELWIVRKQNRLSPQEVRPISTYFVVNENIYMAPSVLSVIQSRLLSTVLSMRQALDQAFSLPNYSPSQGYTYFNQELDVNDSTVTTAPPITTTPPTKGKPALKGPISIQKKMTQVAPSPPKPAMDLASRLAAEVSMDRALSSALFSSTVFLEDMPLIPAPNSNPNSSAEQGSSFPHGSGSEAVALKAVRGRTIPKRGKSTR |
| Length | 284 |
| Position | Head |
| Organism | Nadsonia fulvescens var. elongata DSM 6958 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.411 |
| Instability index | 57.81 |
| Isoelectric point | 9.07 |
| Molecular weight | 31591.49 |
| Publications | PubMed=27535936 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10154
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 140.10| 49| 100| 88| 155| 1
---------------------------------------------------------------------------
88- 155 (72.45/69.40) IVRKQNRLSPQEVRP.IStyfvvneniymapsvlsvIQSRLLSTVlSMRQALDQA.FS................LPNYSPSQGYTY
191- 257 (67.64/35.25) IQKKMTQVAPSPPKPaMD..................LASRLAAEV.SMDRALSSAlFSstvfledmplipapnsNPNSSAEQGSSF
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GSGSEAVALKAVRGRTIPKRGKST 2) ISIQKKM | 260 189 | 283 195 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab