<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10147
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MYGTNVATPGSQGFNDQENMNNQELKEGDLSILDIMDETCGIILHHRIPIGKTRDRLSLITGYLLKPKSDGGSDEGTGNRTPLYGVNSSTDFLASIEISIVNSPIPSLFALKVLLKQYRNLASLGFVSGVTNKQNSLIPWHISACDKMLRVFTNVY |
| Length | 156 |
| Position | Kinase |
| Organism | Nadsonia fulvescens var. elongata DSM 6958 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.172 |
| Instability index | 27.40 |
| Isoelectric point | 6.27 |
| Molecular weight | 17133.33 |
| Publications | PubMed=27535936
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10147
No repeats found
No repeats found
|