Description | Mediator of RNA polymerase II transcription subunit 13 |
Sequence | MYGTNVATPGSQGFNDQENMNNQELKEGDLSILDIMDETCGIILHHRIPIGKTRDRLSLITGYLLKPKSDGGSDEGTGNRTPLYGVNSSTDFLASIEISIVNSPIPSLFALKVLLKQYRNLASLGFVSGVTNKQNSLIPWHISACDKMLRVFTNVY |
Length | 156 |
Position | Kinase |
Organism | Nadsonia fulvescens var. elongata DSM 6958 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.172 |
Instability index | 27.40 |
Isoelectric point | 6.27 |
Molecular weight | 17133.33 |
Publications | PubMed=27535936 |
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
ECO:0000256 RuleBase:RU364134 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10147 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) NRTPLY 2) RLSLITGYLLKPKSDG | 79 56 | 84 71 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab