<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10145
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MESPDISAVPVEALEQLRLRLTQVTHSLGKLQAQLHQPSLPSWPSLQSQFIILLTQLISLSQTLSLHSDILQQTVAYPLPNFPSRTEEGLLTTLLRKKPLPEVEKWVNNGHELAQGIKVKDVEDFCSWAAEVVRDIRDNHMWFGFSTQRELDDGAVAEEYTLKAAEEDDGGIPVDKVLQFMYQGREPSAQQVIPPRPFNAMRN |
Length | 203 |
Position | Head |
Organism | Nadsonia fulvescens var. elongata DSM 6958 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.345 |
Instability index | 46.45 |
Isoelectric point | 5.02 |
Molecular weight | 22937.80 |
Publications | PubMed=27535936
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | protein-macromolecule adaptor activity GO:0030674 IEA:EnsemblFungi
RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:EnsemblFungi
TBP-class protein binding GO:0017025 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP10145
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.66| 16| 18| 74| 89| 1
---------------------------------------------------------------------------
74- 89 (29.38/20.16) TV..AYPLPNFPSRTEEG
93- 110 (24.28/15.52) TLlrKKPLPEVEKWVNNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.36| 11| 17| 39| 49| 4
---------------------------------------------------------------------------
39- 49 (21.67/11.26) SLPSWPSLQSQ
59- 69 (18.70/ 8.95) SLSQTLSLHSD
---------------------------------------------------------------------------
|