<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10141
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSEPSTVDHQLSEEPTRWEIELEFVQSLANPMYLNYLAQMKYLEDEQFLAYLEYLAYWQKPEFSKYLIYPNCLHILRLLRYPMFRQEILRADVAKLFMDEFYMKWLKMGAVGTDDSISEDISPEAKKAKDVKGEAGNSVENERNTLDVKLENGGNGVV |
Length | 158 |
Position | Middle |
Organism | Nadsonia fulvescens var. elongata DSM 6958 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.455 |
Instability index | 55.41 |
Isoelectric point | 4.71 |
Molecular weight | 18474.83 |
Publications | PubMed=27535936
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10141
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.53| 10| 15| 130| 139| 2
---------------------------------------------------------------------------
130- 139 (18.74/16.86) DVKGE.AGNSV
147- 157 (14.79/11.84) DVKLEnGGNGV
---------------------------------------------------------------------------
|