<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10104
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDYFAYSPFWDSRSNNNVLRTQRRIENPTYGHAEEKIELNAFMSGFEYIVAHSQPPNLFVIHRRDVESSGKRDHVTGAWFILQEKIYQCPSLYDVMSARLKNATSLISKTMRTLSDNRPPANPRTTTLWRSLPPSTSKPGPSSNQSPVVESDHAEAPADSPKELDLGEKPAGKTKEQVQEPDWHLFYALQSTRASLASLTAMSRAPGKKLDPKEELKSIEAAITQQFGGGGGQESVNGRSVVPRVAGASGAGSVKGSGVPKAGSLLGAPTPQGGWLGATPGQGTGSPAALSHGVTPDITGSPAKFLNEKLVSQHGVNGQPPLAGASYTGTQ |
Length | 331 |
Position | Head |
Organism | Cryptococcus amylolentus CBS 6039 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.560 |
Instability index | 59.38 |
Isoelectric point | 9.02 |
Molecular weight | 35314.04 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10104
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.50| 14| 15| 229| 243| 1
---------------------------------------------------------------------------
229- 243 (23.00/15.84) GGGGQESVNGrSVVP
247- 260 (26.50/13.72) GASGAGSVKG.SGVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.90| 14| 15| 267| 280| 2
---------------------------------------------------------------------------
267- 280 (28.92/15.91) GAPTPQGGWLGATP
283- 296 (25.98/13.53) GTGSPAALSHGVTP
---------------------------------------------------------------------------
|