<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10103
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MASSSHSPFDDLRVSLDPTTIDLALGQKRVKAIDHDGTIIYEDDESLETDLTSQLERIWNEYPNGLLDLSESKLASLPPDAIAFQSKPEDGEGEGGGGEGGKKKRDVFKMMEWDEMERLRSEMYMQLNDARNELWFALELVKTLSVSSAYTSQPPPPPTTLHQNQNQNQKKQPKPKPTPAPPVPPPTIPGEPPILPPGTYTTTPSSLPSVPLHSTVNDLIQLVHARDKAVGEALGLVDGAVEELELMGRAGDRFWRDVRGLREGKGGRGRWAIVPKPDFARPTPTKDGEKAKDVIIPYAIDEASPATRSRCIAGFDLDPTIPTSLSFPARGYRRVRVVVRDKAAGTVVSSGVEAEGKAGDVGEEMVRAQMEAFDEDLFTQIRIEASILDKSIIEPTQVQIQIPTSSHTLIFQLYSPPSAPSPSPSPSPSHSQTPTSPLCKLLLASARLNLLSGLRVQKQILVAPSPSLRTPSSSSSSPGGVIGSLVEGLEFKSLWEGVQSVVAFLGKALEGAGVEAEVGWEVVSAGKGNETGDRGIMSLLGQVLQGQKLGEGLKVVWSLSLGDSGTIKVSLSPPTSLLITLPSHNATPTPSNANANPSGPPPPGRPPSPSNANSDPTKSTSSFPLTNPEELSYILAGELERQLLAGIEGRLKARSLREFGGGKGKGKEVWWDKLVGVVQVGRRTLRVSLPPPYHTIYAFISSPPTPPSPPTPPARAVVGDDGGNDVGQDGTVVETEGKQEKEEEDSEEKKKKEGEEKYDSRDSEGGLWNWVDGLEL |
| Length | 776 |
| Position | Head |
| Organism | Cryptococcus amylolentus CBS 6039 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.478 |
| Instability index | 53.79 |
| Isoelectric point | 5.12 |
| Molecular weight | 83323.76 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10103
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 288.41| 101| 135| 464| 575| 1
---------------------------------------------------------------------------
351- 437 (82.34/35.42) GVEA........EgkagdVGEEMVRAQM..EA.FDED...LFTQIRIeasilDKSIIEPTQVQIQIPTS.SHTLIFQLySPPSaPSPsPS............P..SPSHSqtPTSP....................................
464- 512 (35.16/22.46) ....................................................................................PSP.SL............R..TPSSS..SSSPGGVIGS..LVEGLEFKSLWEGvqsvvaFLGKALEgA
513- 599 (94.29/51.28) GVEA........E.....VGWEVVSAGKGNET.GDRGimsLLGQVLQ.....GQKLGEGLKVVWSLSLGdSGTIKVSL.SPPT.......sllitlpshnatP..TPSNA..NANPSG..................................
600- 645 (37.50/11.33) ....................................................................................PPP.PG............RppSPSNA..NSDPTKSTSSfpLTNPEELSYILAG......ELERQLL.A
646- 693 (39.12/11.57) GIEGrlkarslrE.....FGG...GKGKGKEVwWDK....LVGVVQV.....GRR.................TLRVSL.PPPY.....................................................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.46| 21| 24| 274| 297| 2
---------------------------------------------------------------------------
153- 173 (38.60/13.30) QPP.PPPTTLHQNQNQNQKKQP
276- 297 (32.87/14.64) KPDfARPTPTKDGEKAKDVIIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.77| 10| 168| 91| 100| 4
---------------------------------------------------------------------------
91- 100 (20.68/11.03) GEGEGGGGEG
260- 269 (20.10/10.49) GLREGKGGRG
---------------------------------------------------------------------------
|