<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10101
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSSPQPPRQSLLQNLSTQSLLLTHLFTALSLPLTPQTPPQISQLHTALQYSALDLAGLVKEVEEHQKLWNKLQEKKEEVKQLEIRVRGLVRNLEEGRRTLEGMVDQGVKEVAAIDKSEKEPILAKTLLAHAQALGKHSSAPVSTLLAPVDRAQYTPWPTEMNMRMGLLFQLEGSMSGMGETGVVGDQQAAQPEAEERREEPVQVEETGRRYDPNAVFQLDLNSDDSDDD |
| Length | 229 |
| Position | Middle |
| Organism | Cryptococcus amylolentus CBS 6039 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.560 |
| Instability index | 58.56 |
| Isoelectric point | 4.93 |
| Molecular weight | 25482.48 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10101
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.25| 11| 30| 57| 67| 1
---------------------------------------------------------------------------
57- 67 (19.06/12.05) GLVKEVEEHQK
88- 98 (19.19/12.16) GLVRNLEEGRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.23| 23| 77| 100| 122| 2
---------------------------------------------------------------------------
100- 122 (35.98/24.21) LEGMVDQGV...KE.VAAIDKSEK..EPI
134- 156 (24.71/14.49) LGKHSSAPV...STlLAPVDRAQY..TP.
175- 202 (27.53/16.92) MSGMGETGVvgdQQ.AAQPEAEERreEPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.65| 13| 21| 19| 31| 3
---------------------------------------------------------------------------
19- 31 (22.10/15.26) SLLLTHL.FTALSL
42- 55 (18.55/11.82) SQLHTALqYSALDL
---------------------------------------------------------------------------
|