<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10101

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMSSPQPPRQSLLQNLSTQSLLLTHLFTALSLPLTPQTPPQISQLHTALQYSALDLAGLVKEVEEHQKLWNKLQEKKEEVKQLEIRVRGLVRNLEEGRRTLEGMVDQGVKEVAAIDKSEKEPILAKTLLAHAQALGKHSSAPVSTLLAPVDRAQYTPWPTEMNMRMGLLFQLEGSMSGMGETGVVGDQQAAQPEAEERREEPVQVEETGRRYDPNAVFQLDLNSDDSDDD
Length229
PositionMiddle
OrganismCryptococcus amylolentus CBS 6039
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes> Tremellales> Cryptococcaceae> Cryptococcus.
Aromaticity0.03
Grand average of hydropathy-0.560
Instability index58.56
Isoelectric point4.93
Molecular weight25482.48
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364141

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10101
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.25|      11|      30|      57|      67|       1
---------------------------------------------------------------------------
   57-   67 (19.06/12.05)	GLVKEVEEHQK
   88-   98 (19.19/12.16)	GLVRNLEEGRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.23|      23|      77|     100|     122|       2
---------------------------------------------------------------------------
  100-  122 (35.98/24.21)	LEGMVDQGV...KE.VAAIDKSEK..EPI
  134-  156 (24.71/14.49)	LGKHSSAPV...STlLAPVDRAQY..TP.
  175-  202 (27.53/16.92)	MSGMGETGVvgdQQ.AAQPEAEERreEPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.65|      13|      21|      19|      31|       3
---------------------------------------------------------------------------
   19-   31 (22.10/15.26)	SLLLTHL.FTALSL
   42-   55 (18.55/11.82)	SQLHTALqYSALDL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10101 with Med4 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SGMGETGVVGDQQAAQPEAEERREEPVQVEETGRRYDPNAVFQLDLNSDDSDDD
176
229










Molecular Recognition Features






MoRF SequenceStartStop




1) ERREEPVQVEETGRRYDPNAVFQLDLNSD
196
224