<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10084

Description Mediator of RNA polymerase II transcription subunit 20
SequenceMPITGVFFIPSNPNSSTILSTISERLHTVLSDEPIPVGRWALEHKLMRDTPSCLPASASQRPAQPRWMQFLSLSYYPFHGFVYASEADKSQFGHAAQVQPQPQAPGQPQSQSQAQAPGTAPAQPQPQQTQSTSGTGTSTNSGMIMTTIPLPSSATLFQHFVYACQPFWCHRHTHAVSGGMVYDIGDFRVRIGDVRQTQPVARVRGTVVEVEWRGPSLFDSLVLNHSVAETQGGDGEDDDSGIDVGLGSIEEEDVDAEFAATAGLIREFWGRLGVEGAREAILVPDVGKEVKERLRRWKAQLQEGKKDVGGRGDGEGNGQLLDEDPDPQAGVDIARQFMEIFRFNR
Length345
PositionHead
OrganismAspergillus cristatus
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.08
Grand average of hydropathy-0.454
Instability index51.39
Isoelectric point5.14
Molecular weight37709.58
Publications
PubMed=27267057

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364152
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10084
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.10|      17|      21|      91|     110|       1
---------------------------------------------------------------------------
   91-  110 (29.80/21.35)	QFGHAAQVQPQPQapgQPQS
  115-  131 (34.30/16.59)	QAPGTAPAQPQPQ...QTQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.26|      34|      98|      46|      83|       2
---------------------------------------------------------------------------
   46-   83 (58.16/47.09)	LMRDTPscLPASAS..QR...PAQPRWMQflSLSYYPFHGFVY
  144-  182 (59.10/34.92)	IMTTIP..LPSSATlfQHfvyACQPFWCH..RHTHAVSGGMVY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10084 with Med20 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) FGHAAQVQPQPQAPGQPQSQSQAQAPGTAPAQPQPQQTQSTSGTGTSTNSGMIM
92
145

Molecular Recognition Features

MoRF SequenceStartStop
1) DEDPDPQAGVDIARQFMEIFRFNR
322
345