<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10082

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMNAHMQSSLSTLESKLNLLITSLTTSPTAAGAPAAASAVLDADDSLTSAVETLRQHQENYAKILRLRAEAEKLEERVKGIVSDVETREKEIRTICGDEENDTDSDAEDDSSDYDSDEDVDMSKSRSRKRMNKEVDYKLLLDFARRISKYNHQAAADAAAGTPAAQKLKDKRQQITEQDVAMTGVNGATDTEEGAEPVSSVTKGATSWLDQSANMTREIYMLPYPAEDRIRMGLMGQIQLAAAEGRPGFDSDNEVERLIREAEGQGAAEAIEPAQPGDESRRVDEAAQAAAHAGSAATSGATSGATSGPAPAPKPKATLDLDLYDPEDDEM
Length330
PositionMiddle
OrganismAspergillus cristatus
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.03
Grand average of hydropathy-0.699
Instability index48.73
Isoelectric point4.48
Molecular weight35436.40
Publications
PubMed=27267057

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10082
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     231.11|      59|     133|     106|     164|       1
---------------------------------------------------------------------------
  106-  164 (96.50/51.90)	AEDDSS.DYDSDEDVD.MSKSRSRKRMNKEVDYKLLLDFARRIS.KYNHQAAADAAAGTPAA
  194-  246 (69.56/35.56)	AEPVSSvTKGATSWLD.QSAN.....MTREI.YMLPYPAEDRIRmGLMGQIQLAAAEGRP..
  248-  300 (65.05/32.82)	........FDSDNEVErLIREAEGQGAAEAIEPAQPGDESRRVD.EAAQAAAHAGSAATSGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.93|      19|     275|      25|      43|       2
---------------------------------------------------------------------------
   25-   43 (33.30/15.97)	TSPTAAG.APA.AASAVLDAD
  301-  321 (25.63/10.89)	TSGATSGpAPApKPKATLDLD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10082 with Med4 domain of Kingdom Fungi

Unable to open file!