<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10078
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATGQDTSLEEILWRSPPHVQMMGGFLHSNNILFYFAESPFFDATSNNASLAIQANYNETFRHFVETREAFEGRLSTMQGLEFVVAYDPLQAAAQSETSFAHEPSNIWVIRKQTRRKRSGLDDEVVVLSTFFVVGDCIYMAPSVASVIGNRILSAVTSLTSLLKTASTLPSFTPSYGHTYMPPTIKSSETSQPGIQSQTSKEDSTPMPEGESQGKTSLQGTTTSNIGSTVQDTRTLAESFNLLSRYGDEFMDESPLVGEPGSFILSRSGDVDRTTKQGLQPPTATTSTATNAPTRAGTPQVRVETPGKSDKGGSTPISDEKLRKKKSKIGV |
| Length | 331 |
| Position | Head |
| Organism | Aspergillus cristatus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.429 |
| Instability index | 57.04 |
| Isoelectric point | 5.64 |
| Molecular weight | 35929.65 |
| Publications | PubMed=27267057
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10078
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.76| 25| 109| 193| 220| 1
---------------------------------------------------------------------------
193- 220 (39.19/25.58) PGiqsQTSKEDSTPMPEGESQGKTSLQG
306- 330 (39.57/19.19) PG...KSDKGGSTPISDEKLRKKKSKIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.21| 17| 19| 242| 260| 2
---------------------------------------------------------------------------
242- 260 (27.45/24.15) LLSRYGDefMDESPLVG.EP
264- 281 (26.76/16.10) ILSRSGD..VDRTTKQGlQP
---------------------------------------------------------------------------
|