<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10077
Description |
RNA polymerase II holoenzyme cyclin-like subunit |
Sequence | MAANYWASTQRRHWLFTREKLAEVRDKQREKDMVAHTQFPLPDQRMLNIYFSQQLTKLGKKTSTRQQALATAQIYIKRYYTKNEIRHTNPYLVLATAFYLACKMEECPQHIRLVVGEARSLWPDFIAPDVSKVGECEFSLISEMSSQMIVHHPYRTLTELQRELALTSDEVALAWSVINDHYLTDLPLLHAPHVIAVMAIIVAVVFKPSQAGFHGSAAPALAGAMREGGMNMLTALGDKSGSGPPPRIQKLIGWLAESEVDIRAVVECTQELVSLYEVWEQYSEKNCKELLARMVKTQHLDK |
Length | 302 |
Position | Kinase |
Organism | Aspergillus cristatus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.211 |
Instability index | 41.40 |
Isoelectric point | 7.70 |
Molecular weight | 34355.32 |
Publications | PubMed=27267057
|
Function
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306
ECO:0000256 ARBA:ARBA00003882
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10077
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.63| 10| 25| 149| 160| 2
---------------------------------------------------------------------------
149- 160 (14.35/16.54) IVHHPYrtLTEL
177- 186 (18.27/12.03) VINDHY..LTDL
---------------------------------------------------------------------------
|