<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10074
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPANQPQVHDAAPALAKITKNSTAHPVPANVASQSQFQASPPPPGQAGGGSAAPETPGGKADGGAGGVAGGEPNDPLAPAPDPPSTFASRQRELARDLIIKEQQIEYLISVLPGIGSSEKEQEVRLRELEGELRTVEEERERKVRELRVLRRKLEGVLGGVEKGIYGER |
| Length | 201 |
| Position | Middle |
| Organism | Aspergillus cristatus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.566 |
| Instability index | 59.94 |
| Isoelectric point | 5.20 |
| Molecular weight | 21440.69 |
| Publications | PubMed=27267057
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10074
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.60| 19| 19| 71| 89| 1
---------------------------------------------------------------------------
36- 76 (23.32/ 8.16) NQPQVHDAAPalakitknstahpvpanvasqsQFQ...ASPPPP
77- 98 (28.21/11.26) GQAGGGSAAP......................ETPggkADGGAG
99- 116 (27.08/10.54) GVAGGE...P......................NDP.laPAPDPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.52| 18| 18| 151| 168| 2
---------------------------------------------------------------------------
151- 168 (29.93/21.36) EKEQEVR.LRELEGELRTV
171- 189 (25.59/17.35) ERERKVReLRVLRRKLEGV
---------------------------------------------------------------------------
|