<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10066
| Description |
Related to component of RNA polymerase II holoenzyme |
| Sequence | MTDRLTQLQDAVDQLANQFVASLFYVHKHHDYSTLGPNDTVRQEAKNAGDPVGNEADGSLPSLFQFSAIRLNPFSVNPYPADVFKAAQKELAQDLILKEQQIELLISLLPGLENSEKDQERMIRQLEKEIKEQDEIHKVALKENKETLERLEAVIRDVKRP |
| Length | 161 |
| Position | Middle |
| Organism | Rhynchosporium commune |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Helotiales incertae sedis> Rhynchosporium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.607 |
| Instability index | 39.73 |
| Isoelectric point | 5.04 |
| Molecular weight | 18362.50 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10066
No repeats found
No repeats found
|