<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10063
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSSQDIPLDEIQWKSPPLVQQMQGVHENSVLHYFSNSPFFDPTSNNAILVSQAMYNPNMLDVIQTRAAFEGRLKTMSGLEFIIAEQPAEMAPGTGTGVWVIRKQTRRKKDRDDDEITVHSTYFVVGENIYMAPTVADVLGNRTMSIIISLKNFISGAGKLPEFSPALGHIYAQPPPSTALKPINSHLSQGSKEPTPLPESLQSSKKALPSLSTTSSSFLDNRLLEETINISLKYGDEYMDDIPITGAPGEFHLSSTGRNEAAKLLVPTITVQPSSDASKPTTPAPPSPLKTEIPPEKKTSKGEKSPKTPGMPKPKRRKSKGLNLVSGGANPTT |
| Length | 333 |
| Position | Head |
| Organism | Rhynchosporium commune |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Helotiales incertae sedis> Rhynchosporium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.468 |
| Instability index | 59.07 |
| Isoelectric point | 8.54 |
| Molecular weight | 36162.73 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10063
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.78| 21| 86| 71| 91| 1
---------------------------------------------------------------------------
71- 91 (36.79/26.60) GRLKTMS.GLEFIIAEQPAEMA
158- 179 (34.99/24.92) GKLPEFSpALGHIYAQPPPSTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.98| 16| 16| 287| 302| 3
---------------------------------------------------------------------------
287- 302 (29.05/13.14) SPLKTEIP.PEKKTSKG
305- 321 (25.93/11.00) SPKTPGMPkPKRRKSKG
---------------------------------------------------------------------------
|