<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10062

Description Related to SRB8-DNA-directed RNA polymerase II holoenzyme and Srb10 CDK subcomplex subunit
SequenceMTTRPMGRQPPQRSLSSTAAIHQRPPPNRTQSQQFTSSSPTRRGNDGGFVDLALDGDVARPRIGTSRLRVEISTDSKQADGPDSSRPSSAATPTWRPSLPPRGRPQLHFNVPSVLISRAAQEGGHQDSTIKPMPLPVRPGQHVPPPARKERPLPTSTSKKDARPKPYTLEVPAIAPRYTPNGHADFYPWTGNHPEDQFSEPVIRQGYFDKAQMTQNETGSAKPAISPALKHKSGLQTLSALFTNVLAQRRAHGQINSASTFKPPPRVTVTDTKREMWLKDLANPTISLRRLSRSIPHGVRGKVLLDQSLSKNIPIERAVWLAKCVGANELRSFRRKGASGTFAMGGEAKWIRDFTVCVEQFLETIVGSCGEKDFKARITYAIRLATHFHAEHLLDREHYMDWLMSSLESSHQTKLPIWILVTQVYWKDLLKYRKYGRRLAAALMNHLTETFKSTDHDILAPLIDRLKSLLKGLISTNIDNFVSPKAWSQNREAMTSSFGSEDPQFLSILATIEKRNARLVSTGATKEPTSRTRLIRILDSSLSEPFANELPRTCWDLDADKDMLIRAVVDWSTSSYRPGNTKTFVAARIIRNWVRFGADVTGAILEYLDSLSNTSRTNKPALYHLVSELARSDHFSTPRYLQWLIARGGIYNPEDLAVDGPCSTRLLAELPMSNASDSISGLRSALLGRAEISTDDEEDLIRDCLVFMNEHLSGMQTGVDLDLESKDCAEASNLAGLPRNLSRTIKSELGHWLRQKVRLQMVQPTIPPLDDWDVSPMKGGSSAIIGSDFNTVRGYLEDLDDYSMLADVLKIVTSSNDADVLASCTDTLDLHLETFAAIGALHGLFNILMGRLRALTEEHDAVPRGFLVSMSNLASRIPQENVIAKQLAQELVKSDRKTAADACSPVSDLMAVVESPEVNFTDEIERILASGNSMDQATLERLFLRITQRLEDSWKKSPEQQRSCALLLTRLRTFDAKQFDVLTGAWISRILQMDSRPTLMEALGPLISFGSLALCDVVVSFAVGNEKQQTLGNFDRSSIPQELLHLLVAHCDLAEVMTLEETYRLRIKQANAQKDLRMDILSVIRQAFEASYSIKGSKSRQVDAKSPLEYTDMFNIYQYYILTDAVGFTQSLIMPLLQSSNPDLVDAVNSIVDKLLSATDAGKPITTELLLNIADDFSLPFCQVKLASMLQARDTSMEGDNTSQSEHLADFDRAIESAVEAGRTTWASIIPLLDVSISEHLRRRADTQFLDLFPNLKTNSGDPWKSSRVSRAENLLSIVEATARSISASSSSPDSSTTGFTSDIVLALNGTWLLLANTQSLETKDALISQWLPLLLTFMTIHVSTFEATKTGNESRAKAILALLAIYLLLLASPTPTPSITSLTAQTYDLALHLVDNLPEDIRQQCIRSLRDTTSNPQIAYLFSVAANPTEWLVLSQKDRMNSVTGPDGRPAEKEKFVGFPLKRWEMLGEPTPNVGENDTSLSLTLFGARRG
Length1492
PositionKinase
OrganismRhynchosporium commune
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Helotiales incertae sedis> Rhynchosporium.
Aromaticity0.07
Grand average of hydropathy-0.290
Instability index44.15
Isoelectric point6.68
Molecular weight165450.23
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
DNA-directed 5'-3' RNA polymerase activity	GO:0003899	IEA:UniProtKB-KW
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10062
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.63|      26|     128|      91|     134|       1
---------------------------------------------------------------------------
   61-   87 (42.50/13.63)	PRiGTSRLR.....VEISTDSKQADGPDSS.RP
  101-  132 (38.13/56.24)	PR.GRPQLHfnvpsVLISRAAQEGGHQDSTiKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     180.17|      54|     129|     363|     416|       3
---------------------------------------------------------------------------
  363-  416 (99.11/59.47)	ETIVGSCGEKDFK.....ARI...................TYAIR.....LATHFHAEHL......LDREHY........M......DWLMSSLESS.HQTKLP
  419-  461 (34.21/15.77)	...........................................I......LVTQVYWKDL......LKYRKYgrrlaaalM......NHLTETFKSTdHDILAP
  492-  582 (46.85/24.29)	EAMTSSFGSEDPQflsilATIekrnarlvstgatkeptsrTRLIRildssLSEPF.ANELprtcwdLDADKD........MliravvDWSTSSYRPG.N.TK..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.33|      14|     117|     848|     868|       4
---------------------------------------------------------------------------
  849-  868 (14.58/18.01)	MGRLRALteehDAvpRGFLV
  968-  981 (23.75/12.92)	LTRLRTF....DA..KQFDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.32|      14|     117|      25|      39|       6
---------------------------------------------------------------------------
   26-   39 (26.51/ 9.20)	PPNRTQSQQFTSSS
  145-  158 (25.81/ 9.85)	PPARKERPLPTSTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.09|      29|     374|     800|     835|       8
---------------------------------------------------------------------------
  800-  829 (44.21/35.79)	DDYSMLADVLKIVTSS..NDAD....VLAScTDTLD
  901-  935 (41.88/17.29)	DACSPVSDLMAVVESPevNFTDeierILAS.GNSMD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.02|      21|     560|     309|     338|       9
---------------------------------------------------------------------------
  273-  293 (37.28/23.07)	KREMWLKDL..ANPTISLRRLSR
  316-  338 (32.74/18.94)	ERAVWLAKCvgANELRSFRRKGA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10062 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FSEPVIRQGYFDKAQMTQNETGSAKPAISPALK
2) MTTRPMGRQPPQRSLSSTAAIHQRPPPNRTQSQQFTSSSPTRRGNDGGFVDLALDGDVARPRIGTSRLRVEISTDSKQADGPDSSRPSSAATPTWRPSLPPRGRPQLHFNVPSVLISRAAQEGGHQDSTIKPMPLPVRPGQHVPPPARKERPLPTSTSKKDARPKPYTLEVPAIA
198
1
230
175










Molecular Recognition Features






MoRF SequenceStartStop




1) EKFVGFPLKRWEMLG
1455
1469