Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEGIKTDHPQTPPSIPSDEPKYGGFTRFEIELEFVQALASPFYLNHLASQKYLEDPAFIAYISYLQYWQHPPYAKFLNYPGPTLKNLELLQQERFRADILSPEIVAKLFEEGVKKGLEGPGS |
Length | 122 |
Position | Middle |
Organism | Rhynchosporium commune |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Helotiales incertae sedis> Rhynchosporium. |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.434 |
Instability index | 52.50 |
Isoelectric point | 5.13 |
Molecular weight | 13947.67 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10056 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KYGGFTRF 2) YISYLQYW | 21 61 | 28 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab