<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10045
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MESLDEIQWKSPEFIQERGGNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPPGVSFHQYFQSRLSEMTGIEFVIAYTKEPDFWIIRKQKRQDPQNTVTLQDYYIIGANVYQAPRIYDVLSSRLLASVLSIKNSTDLLNDMTSYHISDGGHSYINSIHGSSSKPSQSSAVSKPSSTNTGTNATTTPITLTTPSGATVPSTVSNGISTSTEIASGVFDTLLNDVVMNDDHLYIDEIPLYGEGSTLERLGLKGNKDAGLSL |
| Length | 263 |
| Position | Head |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.373 |
| Instability index | 38.07 |
| Isoelectric point | 4.87 |
| Molecular weight | 29162.09 |
| Publications | PubMed=15123810
PubMed=17419877
PubMed=24025428
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP10045
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.58| 14| 17| 86| 99| 2
---------------------------------------------------------------------------
86- 99 (27.37/21.06) DFWIIRKQKRQDPQ
106- 119 (26.21/19.89) DYYIIGANVYQAPR
---------------------------------------------------------------------------
|