Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MESLDEIQWKSPEFIQERGGNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPPGVSFHQYFQSRLSEMTGIEFVIAYTKEPDFWIIRKQKRQDPQNTVTLQDYYIIGANVYQAPRIYDVLSSRLLASVLSIKNSTDLLNDMTSYHISDGGHSYINSIHGSSSKPSQSSAVSKPSSTNTGTNATTTPITLTTPSGATVPSTVSNGISTSTEIASGVFDTLLNDVVMNDDHLYIDEIPLYGEGSTLERLGLKGNKDAGLSL |
Length | 263 |
Position | Head |
Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.373 |
Instability index | 38.07 |
Isoelectric point | 4.87 |
Molecular weight | 29162.09 |
Publications | PubMed=15123810 PubMed=17419877 PubMed=24025428 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP10045 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.58| 14| 17| 86| 99| 2 --------------------------------------------------------------------------- 86- 99 (27.37/21.06) DFWIIRKQKRQDPQ 106- 119 (26.21/19.89) DYYIIGANVYQAPR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EIPLY 2) MESLDEIQWKSPEFI 3) NVLEYFSLSPFY | 238 1 24 | 242 15 35 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab