<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10040

Description Putative mediator of RNA polymerase II transcription subunit 26c
SequenceMDRGERLGRALDAFGGNLWALVDAALDAAARDRPDELRARRDSIVERLYAAAAGCSNCAGRPPSVAALAAAGLEEEDGEEAAPASPWAEADAQAGGAEAQTEVLGAGEPDLESKIVAIRDFLEDPNQPENELVSLLQNLADMDVTYNALQETDIGRQVNGLRKHPSAEVRRLVKQLIRKWKEIVDDWVRLDNSGGDGSASVMTADGDSPHKIQGRSHQSPRVSGFQYSPSPQRFNGSTSEMANNGFESTMDAKRRASPVPAHHNSRQMNNNHHSTTITTSTSSAPASVQKVTREQKQSLVDLDRLDSARKRLQENYQEAQNAKKQRTIQVMDINDIPKPKSRNAFIRKSGSGGLPARHR
Length359
PositionUnknown
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.04
Grand average of hydropathy-0.768
Instability index50.66
Isoelectric point6.12
Molecular weight39115.80
Publications
PubMed=19965430

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10040
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     164.13|      49|      63|     118|     168|       1
---------------------------------------------------------------------------
  118-  168 (77.16/43.05)	IRDFLEDPNQPENELVSLLQnlADMDVTYNALQETDIGRQVNGLRKHPSAE
  184-  232 (86.97/43.94)	VDDWVRLDNSGGDGSASVMT..ADGDSPHKIQGRSHQSPRVSGFQYSPSPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.65|      18|      26|     241|     266|       2
---------------------------------------------------------------------------
  241-  258 (31.68/35.52)	MANNGFESTMDAKRRASP
  268-  285 (31.97/14.87)	MNNNHHSTTITTSTSSAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.01|      16|      16|      51|      66|       3
---------------------------------------------------------------------------
   51-   66 (30.42/19.38)	AAAGCSNCAGRPPSVA
   69-   84 (26.59/16.04)	AAAGLEEEDGEEAAPA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10040 with Med26 domain of Kingdom Viridiplantae

Unable to open file!