<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10003
| Description |
Putative mediator of RNA polymerase II transcription subunit 26b |
| Sequence | MAAPPQPLASLDYWRCFFSGARASIFDAIDAAIRVAAADHPDALRARRDAIAERLYTAIVALPATQEAPGQSTPGQPALLLPEGAASVPSLCSSDRAEVVNNDGGGAPLTNSDDDVVAEAFRIKAALSNAQDKSEAELLELLGRLGQLEFTVDAIRRLDGYC |
| Length | 162 |
| Position | Unknown |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.040 |
| Instability index | 36.46 |
| Isoelectric point | 4.50 |
| Molecular weight | 17063.94 |
| Publications | PubMed=19965430
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10003
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.75| 17| 17| 43| 59| 1
---------------------------------------------------------------------------
27- 48 (20.89/10.20) DAIDAAIRVAAadhpdALRARR
49- 66 (23.87/12.50) DAIAERLYTAI....vALPATQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.10| 11| 17| 83| 99| 2
---------------------------------------------------------------------------
83- 95 (12.01/19.29) EGAASvPsLCSSD
103- 113 (21.10/ 6.68) DGGGA.P.LTNSD
---------------------------------------------------------------------------
|