<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09904
Description |
Putative ribosomal protein S4 (RPS4A) family protein |
Sequence | MVGLPRRLSRDSRVLMIYKSLLYGKLAGNMLHLIEACILRKLIDTSAYLWPGYVVPSGTLKDTALPQESPWLNFMKVSRLSGPLIDALVASPASRCFKLCKVRSVQFGQKGISYLNTYDGRTIRYPDLLIKANDTIKIDLETNKIMDFFKFDVSNVFMVTGGRNTRRVGVIKNWEKHKASFEVIDVLLGAFCMLCLVFSYLLYKKT |
Length | 206 |
Position | Tail |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.130 |
Instability index | 32.43 |
Isoelectric point | 9.71 |
Molecular weight | 23415.51 |
Publications | PubMed=19965430
|
Function
Annotated function |
|
GO - Cellular Component | cytosolic small ribosomal subunit GO:0022627 IBA:GO_Central
integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | RNA binding GO:0003723 IBA:GO_Central
rRNA binding GO:0019843 IEA:UniProtKB-KW
structural constituent of ribosome GO:0003735 IBA:GO_Central
|
GO - Biological Process | translation GO:0006412 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP09904
No repeats found
|