<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09882
Description |
Mediator of RNA polymerase II transcription subunit 15a |
Sequence | MDGAANWRPTQGADPATVAAVGGVDPNAAAPTGSDWRTQLQPEARQRIVNKMYVFSI |
Length | 57 |
Position | Tail |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.404 |
Instability index | 35.64 |
Isoelectric point | 5.96 |
Molecular weight | 6055.69 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09882
No repeats found
|