<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09860
| Description |
Putative mediator of RNA polymerase II transcription subunit 19b |
| Sequence | MDPDDKKFGNGPRELTGAVDLISHYKLLPHHDFFCKKPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVHNAYLRDKPAYIQPFDMETLGQAFQLRETALVDLPSTEKGIPTISGKPKSESKDKEKKHKRHKDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSGHHEKKRKHEGTEDSVDVHKHKKSKVAHCYYFLADTIAFIEKICLFVFNMDGQLTAAQELQNR |
| Length | 229 |
| Position | Head |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.175 |
| Instability index | 33.00 |
| Isoelectric point | 9.13 |
| Molecular weight | 26576.91 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09860
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 64.84| 15| 15| 123| 137| 1
---------------------------------------------------------------------------
117- 134 (23.35/ 9.98) KPKsesKDKEKKHKRHKD
135- 152 (22.03/ 8.93) KDKehkKHKHRHKDRSKD
165- 180 (19.46/ 6.88) KSG..hHEKKRKHEGTED
---------------------------------------------------------------------------
|