<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09852
Description |
RNA polymerase II transcription mediators |
Sequence | MDGVTQAVENLKKEWGQAVSQLDENITAIESCGKTGKGTEEANYLPRLNGSAQDALQLLKSLQFQLDLLAQQLPTFDEVQSGQATLKSWDEQYKKTLLLGNGEESTIRRRNLQTSALAQPNKRLCSLSEHVPHGYRRKSLFEGLIRYNVLLLRATWFIKVTYLNQLQTRQTPNSISVAGSDNQRSQWTKDVVEYLQHMLDEFCSKEGAFVHPSFREQSSPGPTAGTNQIKMKTKASPAAGDIEEHLVHFKWWYMVAK |
Length | 257 |
Position | Kinase |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.580 |
Instability index | 47.67 |
Isoelectric point | 8.34 |
Molecular weight | 29071.52 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | SNAP receptor activity GO:0005484 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum GO:0006890 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09852
No repeats found
No repeats found
|