<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09819
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MCPRCLSCTPGMSMPRMQQVRIDMIGSACETAEKVIAECRKSYGLGSRQGTNLGPTLDKAQAAKIQEQEGLLRAAVNYGEGLRVPGDQRHPQSLPIHLIEVLPLGDGAQNFGDSSGSYPKNMSTFAPNSVNSQGNQIQASGGQLLGRPAPSPGTTGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTPQQQRQKLMQHSQPLHQPVRPSAAGMLAQSALPQLQDLQGQAQQKLQAITDSFSAEGLKT |
| Length | 251 |
| Position | Head |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.611 |
| Instability index | 63.61 |
| Isoelectric point | 8.88 |
| Molecular weight | 26809.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09819
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.42| 27| 33| 119| 150| 1
---------------------------------------------------------------------------
119- 150 (43.71/28.41) PKNMSTFAPNSVNSqgnqiQASGGQLLGRPAP
160- 186 (51.72/24.08) FENVSTPPMPYANS.....PRSGTNMMNTPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.52| 11| 36| 188| 199| 3
---------------------------------------------------------------------------
188- 199 (17.22/13.87) QHLTPQQQrQKL
227- 237 (20.30/10.98) QDLQGQAQ.QKL
---------------------------------------------------------------------------
|