<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09819

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMCPRCLSCTPGMSMPRMQQVRIDMIGSACETAEKVIAECRKSYGLGSRQGTNLGPTLDKAQAAKIQEQEGLLRAAVNYGEGLRVPGDQRHPQSLPIHLIEVLPLGDGAQNFGDSSGSYPKNMSTFAPNSVNSQGNQIQASGGQLLGRPAPSPGTTGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTPQQQRQKLMQHSQPLHQPVRPSAAGMLAQSALPQLQDLQGQAQQKLQAITDSFSAEGLKT
Length251
PositionHead
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.03
Grand average of hydropathy-0.611
Instability index63.61
Isoelectric point8.88
Molecular weight26809.00
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09819
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.42|      27|      33|     119|     150|       1
---------------------------------------------------------------------------
  119-  150 (43.71/28.41)	PKNMSTFAPNSVNSqgnqiQASGGQLLGRPAP
  160-  186 (51.72/24.08)	FENVSTPPMPYANS.....PRSGTNMMNTPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.52|      11|      36|     188|     199|       3
---------------------------------------------------------------------------
  188-  199 (17.22/13.87)	QHLTPQQQrQKL
  227-  237 (20.30/10.98)	QDLQGQAQ.QKL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09819 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VNYGEGLRVPGDQRHPQSLPIHLIEVLPLGDGAQNFGDSSGSYPKNMSTFAPNSVNSQGNQIQASGGQLLGRPAPSPGTTGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTPQQQRQKLMQHSQPLHQPVRPSAAGMLAQSALPQLQDLQGQAQQKLQAITDSFSAEGLKT
76
251










Molecular Recognition Features






MoRF SequenceStartStop




NANANA