<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09816
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MDPAAAALGAVPAAGAPPPGAAAGDQQAAPRVERLSAGVQQQLNLEGMRARAVGLYKAISRILEDFDVIIRTNPSASPKWQDVLGQFSMVSMELFNIVEDIKNVSKVFVVYPRNVNAENATSMPF |
Length | 125 |
Position | Head |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.023 |
Instability index | 39.81 |
Isoelectric point | 5.33 |
Molecular weight | 13310.10 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09816
No repeats found
No repeats found
|