<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09809
| Description |
Cyclin12 |
| Sequence | MVLLLLYHSILLRVAGAGDSSSTDSPGGSLRRAHRDRGSTMAANFWTSSHCKQLLDPEDVDLVPAADRERGITPEEFRLIKIHMSFHIWRLAQQVKVRQRVVATAIAYFRRVYTRKSMSDYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVFHPYRPLLHFHLFVLAELQVDRCPICRLLQDAGITDLTQFAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTAWFEELRVDMNIVKNISMEILDFYDTYKIDPQRGIPEDKISPVMNKLPAKA |
| Length | 315 |
| Position | Kinase |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.032 |
| Instability index | 46.39 |
| Isoelectric point | 7.08 |
| Molecular weight | 36397.09 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP09809
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.31| 15| 119| 121| 135| 3
---------------------------------------------------------------------------
121- 135 (29.67/20.20) YDPRLVAPTCLYLAS
242- 256 (30.64/21.09) YPPYMIALACIYIAS
---------------------------------------------------------------------------
|