<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09808
| Description |
Cyclin12 |
| Sequence | MVLLLLYHSILLRVAGAGDSSSTDSPGGSLRRAHRDRGSTMAANFWTSSHCKQLLDPEDVDLVPAADRERGITPEEFRLIKIHMSFHIWRLAQQVKVRQRVVATAIAYFRRVYTRKSMSDYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVFHPYRPLLQLLQDAGITDLTQFAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTAWFEELRVDMNIVKNISMEILDFYDTYKIDPQRGIPEDKISPVMNKLPAKA |
| Length | 297 |
| Position | Kinase |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.076 |
| Instability index | 49.31 |
| Isoelectric point | 7.01 |
| Molecular weight | 34246.52 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09808
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.82| 12| 138| 53| 88| 2
---------------------------------------------------------------------------
33- 45 (18.12/30.90) AHRDRGSTmAANF
66- 77 (22.71/30.31) ADRERGIT.PEEF
---------------------------------------------------------------------------
|