<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09805

Description U-box domain-containing protein 35
SequenceMSRALQELMLLEDEASAPCATGQISASTNLPLSDKALTVKSALQELMLSEDKASTHCASGQISGSSNFPISYKAPTVSNALQELMLSEDKDNANFELEKLRIKLEHMKGVCKLVQDESTSASQQMIDLVERRAQEEARLAEVRQRINITTEAARKEREQRYAIEAQARHVRDLAKEEALKKQNLQLRLSREADNVQKLEKLLELGGKSYTVFTWEEMESATSSFSEALKIGSGAFGTVYKGKVHHKTVAIKVLKSDDSHIAKHFEKELEILGKTRHRHLLLLLGACLDRACLVYEYMENGSLEDRLQCKGDTAPLPWYHRFRIAWEITLALIFLHSSKPKPIIHRDLKPANILLDRNFTSKIGDAGLATFLPLRDTSSTHTIRKSTDLVGTLFYLDPEYQRTGQVSAKSDVYALGMVFLQLLTAKSPIGLADTAERAMEEDHLIDILDQRAGNWPVREAHELTQLGLRCLEMRSKDRPDLKSKVLVVLERLNNLASTVYHSVQPIPTAPPSHFICPILKRVMQDPCIASDGYSYERVAIEMWLNENDVSPLTKARLPDKNLVPNLALICLINSWKGEVGATGPIR
Length585
PositionTail
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.05
Grand average of hydropathy-0.316
Instability index37.59
Isoelectric point6.80
Molecular weight65597.60
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP09805
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     144.21|      37|      37|      16|      52|       1
---------------------------------------------------------------------------
   16-   52 (70.46/47.98)	SAPCATGQISASTNLPLSDKALTVKSALQELMLSEDK
   54-   90 (73.75/50.55)	STHCASGQISGSSNFPISYKAPTVSNALQELMLSEDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.05|      19|      39|     133|     152|       5
---------------------------------------------------------------------------
  133-  152 (25.51/20.64)	AQEEArLAEVRQRINITTEA
  174-  192 (29.54/18.71)	AKEEA.LKKQNLQLRLSREA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP09805 with Med32 domain of Kingdom Viridiplantae

Unable to open file!