<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09771
Description |
RNA polymerase II transcription mediators |
Sequence | MLQTRQTPNSILVAGSDNQRSQWTKDVVEYLQHILDEFCSKEGAFVHPSFREQSSPGPIAGTNQIKMKTEASPAAGDIEEPLVHFKWWYMVRLIQWHLTEELLVPSVLIEWLSNQLQERDSVDVLELLLPIMLGLVDTISLSQTYVCMFVRIFLL |
Length | 155 |
Position | Kinase |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.023 |
Instability index | 60.04 |
Isoelectric point | 4.87 |
Molecular weight | 17814.36 |
Publications | PubMed=19965430
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09771
No repeats found
|