<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09742
Description |
Uncharacterized protein |
Sequence | MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHIGVMVGMGQKDAYVGDEVQSKRGILTLKYLSLHITLFPTLQQSVQQSEHLFRDSCNDMGSVNEVPAQPIYIDSFPKLRAWFCKPIMTKPKVALKPQTLSPQPEAQAPHDPQTPEQQQSGTGVGV |
Length | 166 |
Position | Tail |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.320 |
Instability index | 57.52 |
Isoelectric point | 6.05 |
Molecular weight | 18040.43 |
Publications | PubMed=19965430
|
Function
Annotated function |
Essential component of cell cytoskeleton; plays an important
role in cytoplasmic streaming, cell shape determination, cell division,
organelle movement and extension growth.
ECO:0000256 ARBA:ARBA00003589
|
GO - Cellular Component | cytoskeleton GO:0005856 IEA:UniProtKB-SubCell
|
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09742
No repeats found
|