<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09723

Description Putative mediator of RNA polymerase II transcription subunit 26b
SequenceMADGLDRWRGFFRGAGAGICDVIENAILVAAADAPRDFLHRRDRIAERLFTALRRDAAPPSFGSAAASTTPATPVEEDKGSVRRVAEKECKVDSSSNGTHGGGGHGHGHADEDDDSDSDDERLRRAAASNYGHNYDDDDEDGDQQEEDEQQHAADDTEEGEEDHDAEELEALTNEIDEESQIVGEVLRIKELLLHKEDHSDATLFDSLRRLQLMQLSVSTLKATEIGRAVNRLRKHNSREIRHLVCTLIEGWKVLVDEWVSTTNAALTENSPGSSNPSVVDEEEEGLPSPPLDEGAFFATQTTSIQLSEFFDEMDEDGNLRHSNDPSLGNKRGNNGGRLASHSTVARQDPPRSYPGVVERVQPRRLELARQEPPMRQANPQTLQSSSLQAKPHGALNKQSNNPSSYESGPGRPVKAAQQRPFGDMKPKQTREHVAIERKPMASQTDKSRPGARPSAGAKLELAKPKVYDDGLDNNRKLEAAKRRLQERYQEAENGSEKATHDSGNGAG
Length508
PositionUnknown
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.04
Grand average of hydropathy-0.997
Instability index60.15
Isoelectric point5.03
Molecular weight55816.07
Publications
PubMed=19965430

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09723
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.11|      19|      20|     332|     351|       1
---------------------------------------------------------------------------
  315-  333 (30.05/14.15)	DEDGNL.RHSNDPSLGNKRG
  334-  353 (30.06/18.04)	NNGGRLaSHSTVARQDPPRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     137.82|      40|      61|     381|     420|       2
---------------------------------------------------------------------------
  362-  389 (31.99/12.36)	............QPRRLELARQEPPMRQANPQTLQSSSLQ
  390-  429 (69.43/34.33)	AKPHGALNKQSNNPSSYESGPGRPVKAAQQRPFGDMKPKQ
  430-  459 (36.40/14.94)	TREHVAIERKPMASQTDKSRPGARPSAGAK..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.85|      20|      20|     137|     156|       3
---------------------------------------------------------------------------
  111-  130 (31.58/15.27)	DEDDDSDSDDERLRRAAASN
  137-  156 (35.27/17.92)	DDDEDGDQQEEDEQQHAADD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.86|      18|      20|     460|     477|       4
---------------------------------------------------------------------------
  460-  477 (30.77/19.80)	LELAKPKV...YDDGLDNNRK
  478-  498 (24.09/13.95)	LEAAKRRLqerYQEAENGSEK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09723 with Med26 domain of Kingdom Viridiplantae
Unable to open file!