<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09668
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MAGELGQQTVELGAVVRRAAEESYLALRELVEKSQAEAEGKGIGAGANGSWQRSDTEKKIDLLKFITRTRQRMLRLHVLAKWCQQVPLVHYCQQLGSTLHSHETCFTQTADSLFYMHECLQQARAPMFDVPSAIEVMLTGGYQRLPRCIEEIGSQHKLSPDEEKRALRKLDASVRYRVLVTPRPKEVSNVSVTDGIAVFRVDGEFKILLTLGYRGNVDLWRILHMELLVGEKKGPIKLDESRRFALGDDIERRMAASENPFAVLYAILHEFCISLAMDTIIKQANVLRQGRWKDAIRSELISDSATVQTGNTPLMQLVQDAEFDSSGFKIPGLKVNYWLDEKSTSTAEPDSSPFIKIEAGLDMQIKCQHSSFILDPFTDKEASLSLDLSCIDVEQLILRAVSCNRHTRLLNIQRQLCKNVQIFQSPKDVVLTRDVAAAKDPMMNAEKGFSDCFGNEVLQVRACGQAYVSLGINIRSGRFLLQSPENILPRAALMDCEEALNKGSTSATEVFSSLRTRSILHLLAATGSFFGLKVYQQSQGTLKIPKTLLHGSDLMVMGFPHCANAYYLLMQLDKDFRPVFHLLETQCDANGNTNASGDVKEAIRYNKINIGQMQILKNEMNENPFDVKLQALQSLVDSADMMESDLPVQNAIEPLPLLPACSPSFSSIVDEVFEYERGSTAAQNRCLPVDIQGINARVVSPMHDGCLSYTQANNNMNVHPNVSLNSYFPSNFRHLQGANKSLQLVPSSNDNSNQIPAQSSHSGNLGNATPGHLIGSSTTTGGNTIFQISYQVSLHYEDCNLVSQESGEKKQNQCRVSCLCRHTLLICNQEAVSPMEMFLLKEIIVFRQLYMLLCYYMS |
| Length | 858 |
| Position | Tail |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.211 |
| Instability index | 49.20 |
| Isoelectric point | 6.13 |
| Molecular weight | 95687.42 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
plasmodesma GO:0009506 IEA:EnsemblPlants
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | cold acclimation GO:0009631 IEA:EnsemblPlants
positive regulation of cell population proliferation GO:0008284 IEA:EnsemblPlants
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
systemic acquired resistance GO:0009627 IEA:EnsemblPlants
|
Interaction
Repeat regions
| Repeats |
>MDP09668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 150.90| 47| 412| 97| 148| 1
---------------------------------------------------------------------------
97- 148 (75.35/66.16) STLHSHETCFTQTADSLFYMHECLQQARAPMfDVPSAI....EVMLTGgyqrLPRC
512- 562 (75.55/50.33) SSLRTRSILHLLAATGSFFGLKVYQQSQGTL.KIPKTLlhgsDLMVMG....FPHC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.88| 21| 412| 401| 434| 2
---------------------------------------------------------------------------
410- 431 (33.90/43.25) LNI.QRQLCKNvQIFQSPKDVVL
608- 629 (33.98/ 9.80) INIgQMQILKN.EMNENPFDVKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.14| 15| 23| 353| 367| 9
---------------------------------------------------------------------------
353- 367 (28.23/23.08) PFIKIEAGLDMQIKC
376- 390 (26.91/21.61) PFTDKEASLSLDLSC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 117.57| 31| 31| 654| 684| 10
---------------------------------------------------------------------------
634- 650 (17.47/ 6.88) .............SLVDSA.DMMESDLPVQN
654- 684 (53.22/36.72) PLPLLPACSPSFSSIVDEVFEYERGSTAAQN
688- 714 (46.87/31.42) PVDIQGINARVVSPMHDGCLSY....TQANN
---------------------------------------------------------------------------
|