<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09668

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAGELGQQTVELGAVVRRAAEESYLALRELVEKSQAEAEGKGIGAGANGSWQRSDTEKKIDLLKFITRTRQRMLRLHVLAKWCQQVPLVHYCQQLGSTLHSHETCFTQTADSLFYMHECLQQARAPMFDVPSAIEVMLTGGYQRLPRCIEEIGSQHKLSPDEEKRALRKLDASVRYRVLVTPRPKEVSNVSVTDGIAVFRVDGEFKILLTLGYRGNVDLWRILHMELLVGEKKGPIKLDESRRFALGDDIERRMAASENPFAVLYAILHEFCISLAMDTIIKQANVLRQGRWKDAIRSELISDSATVQTGNTPLMQLVQDAEFDSSGFKIPGLKVNYWLDEKSTSTAEPDSSPFIKIEAGLDMQIKCQHSSFILDPFTDKEASLSLDLSCIDVEQLILRAVSCNRHTRLLNIQRQLCKNVQIFQSPKDVVLTRDVAAAKDPMMNAEKGFSDCFGNEVLQVRACGQAYVSLGINIRSGRFLLQSPENILPRAALMDCEEALNKGSTSATEVFSSLRTRSILHLLAATGSFFGLKVYQQSQGTLKIPKTLLHGSDLMVMGFPHCANAYYLLMQLDKDFRPVFHLLETQCDANGNTNASGDVKEAIRYNKINIGQMQILKNEMNENPFDVKLQALQSLVDSADMMESDLPVQNAIEPLPLLPACSPSFSSIVDEVFEYERGSTAAQNRCLPVDIQGINARVVSPMHDGCLSYTQANNNMNVHPNVSLNSYFPSNFRHLQGANKSLQLVPSSNDNSNQIPAQSSHSGNLGNATPGHLIGSSTTTGGNTIFQISYQVSLHYEDCNLVSQESGEKKQNQCRVSCLCRHTLLICNQEAVSPMEMFLLKEIIVFRQLYMLLCYYMS
Length858
PositionTail
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.07
Grand average of hydropathy-0.211
Instability index49.20
Isoelectric point6.13
Molecular weight95687.42
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
plasmodesma	GO:0009506	IEA:EnsemblPlants
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
cold acclimation	GO:0009631	IEA:EnsemblPlants
positive regulation of cell population proliferation	GO:0008284	IEA:EnsemblPlants
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
systemic acquired resistance	GO:0009627	IEA:EnsemblPlants

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP09668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     150.90|      47|     412|      97|     148|       1
---------------------------------------------------------------------------
   97-  148 (75.35/66.16)	STLHSHETCFTQTADSLFYMHECLQQARAPMfDVPSAI....EVMLTGgyqrLPRC
  512-  562 (75.55/50.33)	SSLRTRSILHLLAATGSFFGLKVYQQSQGTL.KIPKTLlhgsDLMVMG....FPHC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.88|      21|     412|     401|     434|       2
---------------------------------------------------------------------------
  410-  431 (33.90/43.25)	LNI.QRQLCKNvQIFQSPKDVVL
  608-  629 (33.98/ 9.80)	INIgQMQILKN.EMNENPFDVKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.14|      15|      23|     353|     367|       9
---------------------------------------------------------------------------
  353-  367 (28.23/23.08)	PFIKIEAGLDMQIKC
  376-  390 (26.91/21.61)	PFTDKEASLSLDLSC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.57|      31|      31|     654|     684|      10
---------------------------------------------------------------------------
  634-  650 (17.47/ 6.88)	.............SLVDSA.DMMESDLPVQN
  654-  684 (53.22/36.72)	PLPLLPACSPSFSSIVDEVFEYERGSTAAQN
  688-  714 (46.87/31.42)	PVDIQGINARVVSPMHDGCLSY....TQANN
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP09668 with Med14 domain of Kingdom Viridiplantae

Unable to open file!