<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09666

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMVMGFPHCANAYYLLMQLDKDFRPVFHLLETQCDANGNTNASGDVKEAIRYNKINIGQMQILKNEMNENPFDVKLQALQSLVDSADMMESDLPVQNAIEPLPLLPACSPSFSSIVDEVFEYERGSTAAQNRCLPVDIQGINARVVSPMHDGCLSYTQANNNMNVHPNVSLNSYFPSNFRHLQGANKSLQLVPSSNDNSNQIPAQSSHSGNLGNATPGHLIGSSTTTGGLGKLITAGSDGASRKHYLSDFLSSIPSLRGLQPSEPRKRRKKTESVQSLLPLQAHSSNLQSRGSLTYGDVLAERNNCVPATIYASVLLHVIRHCSLCIKHAQLTAQMDSLAIPYVEEVGLRRPSSNLWLRLPFAQDDSWNHICLRLGKAGSMSWDVRINDPHFRELWELNGGSTKTQWGVGIRIANSSEMDSHISFDSSGVVLTYNTVEADSVQKLVSDLRRLSNARSFALGMRRLIGVKFQDKLDDNQLTMEVKSQSVNKGNSDAADKLSEQMRKTFRIEAVGLMSLWFSYGTMPMVHIVVEWEIAKAGCTMHVSPDQLWPHTKFLEDFVNGGEVASFLDCIRLTAGPLLALGGAIRPARMPVAVSSGYSSMPKQPNIPTQGPLVNGSSSTIHHAPGPSNAASAHLGSHNLHAAAMLSAVGRGGPGLVPSSLLPFDVSVVLRGPYWIRIIYRKKFSVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQGLNALEPNFMNATQASGHLNNNAGVPQTAPSANRLNATPGVSMVRPTSGVANHVAASLSRAGNAMLASSALASGISGTSVRLTAGAGLPVHMKGELNTAFIGLGDDGGYGGGWVPLAALKKVLRGILKYLGVLWLFAQLPELLKEILGSILKDNEGALLNLDQEQPALRFYVGGYVFAVSVHRVQLLLQVLSVKRFHHQQQQQQAQSNAQEELAAVEINEICDYFSRRVASEPYDASRVASFITLLTLPILVLREFLKLITWKKGLSPVHGDIATAQRARIELCLENHSGSASSDNTENSSLAKSNIHHDRAHSSVEFALTFVLDHALIPHMNVAGGAAWLPYCVSVKLRYSFGDNNHIAFLAMNGSHGGRACWLQFEEWERCKQKVSRAVETVNGSGVAGEVGQGRLRMVAEMIQKQLQLCLQQLRDDPLSAGSTAS
Length1167
PositionTail
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.07
Grand average of hydropathy-0.143
Instability index49.06
Isoelectric point8.28
Molecular weight126709.93
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09666
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.24|      14|      18|     640|     654|       1
---------------------------------------------------------------------------
  640-  654 (21.24/16.88)	LHAAAML....SAVGRgGP
  656-  673 (18.99/ 8.95)	LVPSSLLpfdvSVVLR.GP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.10|      19|      23|     838|     857|       2
---------------------------------------------------------------------------
  838-  857 (31.90/24.17)	Y.GGGWV....PlAALKKVLRGILK
  858-  881 (25.20/13.61)	YlGVLWLfaqlP.ELLKEILGSILK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      96.34|      23|      23|     736|     758|       3
---------------------------------------------------------------------------
  210-  229 (21.05/ 8.02)	.......NLGNATPGhlIGSSTTTGGL
  732-  754 (39.09/21.13)	NALEP..NFMNATQA..SGHLNNNAGV
  755-  779 (36.21/19.04)	PQTAPsaNRLNATPG..VSMVRPTSGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.62|      19|     408|     560|     581|       7
---------------------------------------------------------------------------
  560-  581 (27.94/26.34)	NGGEVASFldcIRLTAGPLLAL
  964-  982 (31.68/19.41)	DASRVASF...ITLLTLPILVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     193.59|      61|     408|      62|     122|       8
---------------------------------------------------------------------------
   62-  122 (103.35/67.86)	LKNEMNENP..FDVKLQAL.QSLVDSADMMESDLPVQNAIEPLPLLPA.CSPSFSSIVDEVFEYE
  469-  533 (90.24/58.29)	FQDKLDDNQltMEVKSQSVnKGNSDAADKLSEQMRKTFRIEAVGLMSLwFSYGTMPMVHIVVEWE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.42|      16|      18|     591|     608|      10
---------------------------------------------------------------------------
  591-  608 (22.08/20.81)	PVaVSSGYSSMPKQPNiP
  612-  627 (30.34/17.72)	PL.VNGSSSTIHHAPG.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     187.31|      56|      59|     984|    1041|      13
---------------------------------------------------------------------------
  984- 1041 (86.88/52.82)	EFLKLITWKKGLSPvHGDIATAQrARIELCLENHSGSASSDNTENSSLAKSNIHHDRA
 1046- 1101 (100.43/53.64)	EFALTFVLDHALIP.HMNVAGGA.AWLPYCVSVKLRYSFGDNNHIAFLAMNGSHGGRA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09666 with Med14 domain of Kingdom Viridiplantae
Unable to open file!