<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09637
| Description |
Uncharacterized protein |
| Sequence | MASAGVAAGRQAEDALPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVHTNFCTFCRDGI |
| Length | 81 |
| Position | Middle |
| Organism | Macaca mulatta (Rhesus macaque) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.733 |
| Instability index | 100.56 |
| Isoelectric point | 5.08 |
| Molecular weight | 8651.61 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09637
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.27| 14| 16| 23| 36| 1
---------------------------------------------------------------------------
17- 34 (26.11/ 6.05) PPtsdqPLPDTKPLPPPQ
35- 52 (26.16/ 6.07) PPpvpaPQPQQSPAPRPQ
---------------------------------------------------------------------------
|