<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09635
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MSNSKAGRRSCDALPAAYARKMAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL |
| Length | 221 |
| Position | Tail |
| Organism | Macaca mulatta (Rhesus macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.407 |
| Instability index | 76.72 |
| Isoelectric point | 8.09 |
| Molecular weight | 23308.19 |
| Publications | PubMed=17431167
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP09635
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 165.91| 40| 121| 11| 64| 1
---------------------------------------------------------------------------
11- 50 (69.95/24.79) CDALPAAYARKMA...ASQQQASAA........SSAAGVSG..PSSAGGPGPQ
134- 174 (58.24/18.71) CDQLELCL..RLAhecLSQSCDSAK........HSPTLVPT..ATKPDAVQPD
176- 218 (37.71/10.14) ...LP..YPQYLA...VIKAQISCAkdihtallDCANKVTGktPAPPAGPG..
---------------------------------------------------------------------------
|