<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09631
| Description |
Cyclin dependent kinase 19 |
| Sequence | ASLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSGLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSNVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY |
| Length | 392 |
| Position | Kinase |
| Organism | Macaca mulatta (Rhesus macaque) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.776 |
| Instability index | 58.37 |
| Isoelectric point | 8.74 |
| Molecular weight | 44206.22 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09631
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.49| 22| 32| 300| 322| 1
---------------------------------------------------------------------------
300- 322 (37.34/24.76) GGAGAGVGG..TGAGLQHSqDSGLN
333- 356 (39.15/21.59) GPSGANSGGpvMPSDYQHS.SSRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.79| 10| 14| 357| 366| 3
---------------------------------------------------------------------------
357- 366 (19.22/10.89) YQSNVQGSSQ
373- 382 (18.57/10.30) YSSSSQQSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.90| 14| 17| 221| 234| 6
---------------------------------------------------------------------------
221- 234 (26.99/13.96) QDPYFQEDPLPTLD
240- 253 (24.91/12.39) QIPYPKREFLNEDD
---------------------------------------------------------------------------
|