Description | Mediator complex subunit 25 |
Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPPPPGAPQGPPGTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
Length | 177 |
Position | Unknown |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.284 |
Instability index | 78.37 |
Isoelectric point | 6.49 |
Molecular weight | 18115.79 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP09617 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 96.99| 26| 44| 71| 97| 3 --------------------------------------------------------------------------- 71- 97 (49.21/13.01) G.ANPQLRSLLLNPPPPQtGVP...PPQASL 115- 144 (47.78/10.26) GlGQPQLGPPLLHPPPAQ.SWPaqlPPRAPL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ILMDLI 2) RSLLL 3) YFEGLRKHYLL | 172 77 31 | 177 81 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab