<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09617
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPPPPGAPQGPPGTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 177 |
| Position | Unknown |
| Organism | Macaca mulatta (Rhesus macaque) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.284 |
| Instability index | 78.37 |
| Isoelectric point | 6.49 |
| Molecular weight | 18115.79 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09617
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.99| 26| 44| 71| 97| 3
---------------------------------------------------------------------------
71- 97 (49.21/13.01) G.ANPQLRSLLLNPPPPQtGVP...PPQASL
115- 144 (47.78/10.26) GlGQPQLGPPLLHPPPAQ.SWPaqlPPRAPL
---------------------------------------------------------------------------
|