<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09615
Description |
Mediator of RNA polymerase II transcription subunit 1 |
Sequence | MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQSCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGALVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGEPGLNCFTLPENQGALHFSTGWRRRGRINQAWDTSLLSRCTHSSVSKEGKDMKSTSTYLLLLVSYVFSV |
Length | 616 |
Position | Middle |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.185 |
Instability index | 51.08 |
Isoelectric point | 8.37 |
Molecular weight | 68428.15 |
Publications | PubMed=17431167
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09615
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 205.31| 48| 48| 146| 193| 2
---------------------------------------------------------------------------
146- 193 (82.98/61.98) NFDEFSKHL........KGLVNLYNL..........P..GDNKLKTKMYLALQSLEQ.DLSKMAIMYWK
196- 244 (71.32/52.07) NAGPLDKIL........HGSVG.YLT..........PrsGGHLMNLKYYVSPSDLLD.DKTASPIILHE
246- 306 (51.02/34.82) N...VSRSLgmnasvtiEGTSAMYKLpiaplimgshP..VDNKW.TPSFSSITSANSvDLP..ACFFLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.81| 21| 25| 319| 339| 3
---------------------------------------------------------------------------
319- 339 (39.40/21.51) Q.KL.QSCTGIPLFETQPTYAPL
345- 367 (29.42/14.41) QfELsKDPDPIPLNHNMRFYAAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.16| 26| 53| 396| 424| 4
---------------------------------------------------------------------------
396- 424 (38.88/38.96) ITFQHPGRVPLIlnLIRHQVAYNTLIgSC
452- 477 (48.29/34.24) VSFQHPVNDSLV..CVVMDVQDSTHV.SC
---------------------------------------------------------------------------
|