<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09614
| Description |
Cyclin dependent kinase 19 |
| Sequence | MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSGLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSNVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY |
| Length | 398 |
| Position | Kinase |
| Organism | Macaca mulatta (Rhesus macaque) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.758 |
| Instability index | 60.33 |
| Isoelectric point | 8.68 |
| Molecular weight | 44910.10 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.49| 22| 32| 306| 328| 1
---------------------------------------------------------------------------
306- 328 (37.34/27.26) GGAGAGVGG..TGAGLQHSqDSGLN
339- 362 (39.15/23.78) GPSGANSGGpvMPSDYQHS.SSRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.79| 10| 14| 363| 372| 4
---------------------------------------------------------------------------
363- 372 (19.22/11.27) YQSNVQGSSQ
379- 388 (18.57/10.66) YSSSSQQSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.90| 14| 17| 227| 240| 8
---------------------------------------------------------------------------
227- 240 (26.99/14.75) QDPYFQEDPLPTLD
246- 259 (24.91/13.09) QIPYPKREFLNEDD
---------------------------------------------------------------------------
|