<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09602
Description |
Cyclin C |
Sequence | STCTFRGLSTSRLKWEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
Length | 200 |
Position | Kinase |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.178 |
Instability index | 48.74 |
Isoelectric point | 6.79 |
Molecular weight | 23291.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 132| 145| 1
---------------------------------------------------------------------------
132- 145 (20.63/16.53) QW..FAELSvDMEKIL
157- 171 (20.73/11.77) QWknFDERK.EMATIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.43| 20| 27| 56| 77| 3
---------------------------------------------------------------------------
56- 77 (34.97/29.78) EFYLLELmdCCLIVYHPYRPLL
86- 105 (37.46/24.38) EDMLLPL..AWRIVNDTYRTDL
---------------------------------------------------------------------------
|