<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09593
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | SGFSSDEYLSLVARLIIHFRDIHNKKSQASVSAQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQFQAQQSAMQQQF |
Length | 81 |
Position | Tail |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -1.004 |
Instability index | 96.18 |
Isoelectric point | 8.27 |
Molecular weight | 9472.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09593
No repeats found
|