<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09588
Description |
Uncharacterized protein |
Sequence | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLAGLKCITRAGHDWTIPQSSHLVLPEVCH |
Length | 70 |
Position | Tail |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.187 |
Instability index | 43.08 |
Isoelectric point | 9.39 |
Molecular weight | 8162.50 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09588
No repeats found
No repeats found
|