<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09587
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSSGEKEKERLGGGLGVASGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGYVSKNVLTLIFKNMIELNAVFIVLGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD |
| Length | 266 |
| Position | Middle |
| Organism | Macaca mulatta (Rhesus macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.557 |
| Instability index | 47.17 |
| Isoelectric point | 5.02 |
| Molecular weight | 29530.05 |
| Publications | PubMed=17431167
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP09587
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.23| 25| 29| 28| 54| 1
---------------------------------------------------------------------------
30- 54 (40.78/33.09) LLSALED...LEVL.SR..ELIEMLAISRNQ
56- 86 (28.45/14.18) LLQAGEEnqvLELLiHRdgEFQELMKLALNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.74| 24| 24| 210| 233| 2
---------------------------------------------------------------------------
210- 233 (46.21/29.97) D.VLAPQYPWQSNDMSMNMLPPNHS
235- 259 (36.54/22.33) DfLLEPPGHNKENEDDVEIMSTDSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.13| 11| 15| 109| 122| 3
---------------------------------------------------------------------------
109- 119 (17.43/21.68) QLQKQLKEAEQ
127- 137 (16.69/ 6.98) QAKEKLKSIEK
---------------------------------------------------------------------------
|