Description | Mediator complex subunit 25 |
Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPPPPGAPQGPPGTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
Length | 187 |
Position | Unknown |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.286 |
Instability index | 78.98 |
Isoelectric point | 6.16 |
Molecular weight | 19161.92 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP09581 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 83.06| 23| 67| 67| 103| 3 --------------------------------------------------------------------------- 67- 101 (42.79/19.08) GPPPPGPILRPQNP.GanpqlrslllnpPPPQTGVP 151- 174 (40.27/ 9.55) RAPLPGQMLLSGGPrG............PVPQPGLQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.81| 11| 44| 83| 93| 4 --------------------------------------------------------------------------- 83- 93 (21.06/ 6.35) NPQLRSLLLNP 128- 138 (23.75/ 7.97) QPQLGPPLLHP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HYLLPAIEYF 2) LMDLI | 38 183 | 47 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab