<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09574

Description Cyclin dependent kinase 19
SequenceMDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKAPPPQQNSTQTNGTHSQDSGLNQVPPNKKPRLGPSGANSGGPVMPSDYQPLPHCAAPGNTINVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY
Length464
PositionKinase
OrganismMacaca mulatta (Rhesus macaque)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca.
Aromaticity0.09
Grand average of hydropathy-0.641
Instability index50.11
Isoelectric point8.49
Molecular weight52982.71
Publications
PubMed=17431167

Function

Annotated function
GO - Cellular Component
cytosol	GO:0005829	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
protein phosphorylation	GO:0006468	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP09574
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     172.69|      41|      41|     336|     376|       1
---------------------------------------------------------------------------
  304-  332 (36.51/16.75)	.....PDSKVFLL.LQ......KLLTM.DPTKRITSEQALQD
  336-  376 (74.15/40.82)	QEDPLPTLDVFAG.CQIPYPKREFLNEDDPEEKGDKAPPPQQ
  380-  419 (62.02/33.07)	QTNGTHSQD..SGlNQVPPNKKPRLGPSGANSGGPVMPSDYQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      35|     151|     165|       2
---------------------------------------------------------------------------
  151-  165 (26.77/16.89)	DLKPANILVMGEGPE
  189-  203 (28.67/18.56)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP09574 with CDK8 domain of Kingdom Metazoa

Unable to open file!