<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09571
| Description |
Cyclin dependent kinase 19 |
| Sequence | MLSMTCGLPINHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKV |
| Length | 277 |
| Position | Kinase |
| Organism | Gallus gallus (Chicken) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.395 |
| Instability index | 46.43 |
| Isoelectric point | 8.23 |
| Molecular weight | 32107.94 |
| Publications | PubMed=15592404
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09571
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 36| 57| 71| 2
---------------------------------------------------------------------------
57- 71 (26.77/16.99) DLKPANILVMGEGPE
95- 109 (28.67/18.64) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|