<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09567
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MKLAVDQGKIHHEMQLLEKVVEKRDNDIQQLQKQLKEAEHILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSMNMLPPNHSNDFMLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
Length | 191 |
Position | Middle |
Organism | Gallus gallus (Chicken) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.713 |
Instability index | 52.25 |
Isoelectric point | 5.35 |
Molecular weight | 21125.50 |
Publications | PubMed=15592404
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP09567
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.94| 32| 38| 4| 41| 1
---------------------------------------------------------------------------
4- 41 (39.70/41.64) AVDQGKihHEMQLLEKvveKRDNDIQQlQKQLKEAEHI
45- 76 (51.23/32.03) AVYQAK..EKLKSIEK...ARKGAISS.EEIIKYAHRI
---------------------------------------------------------------------------
|