<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09563
| Description |
Uncharacterized protein |
| Sequence | MKVAAQNLVQNSNIDNGQKSADGALQRFDKSLEEFYALCDQLELCLRLAHECLSQSFDSAKHAPALVPAAPKGEGAAGESLPYTQYLPLIKAQIAGAKDIHNALLEGANKITGKLPPTGGP |
| Length | 121 |
| Position | Tail |
| Organism | Gallus gallus (Chicken) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.252 |
| Instability index | 49.35 |
| Isoelectric point | 5.86 |
| Molecular weight | 12784.38 |
| Publications | PubMed=15592404
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP09563
No repeats found
No repeats found
|