<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09561

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMQIWRRRSGPPPGLSSAVPEGAAARREQPAGSWHGCACAVELSRLRSTPPPVPGSSDGFGVRVRVGEAAEERPLPAHPAGVRLVLPQPHRLHHRPAERGGARCGPPPFPPPPLTHSPRCSRGPSAFPLPPPRPANGAGVRLSLRADLTHMVHIIDTEHPWDVYSVNSGHVEAITCLEWDQSGSRLLSADADGHIKCWSMTDHLANSWENTMGSMVEGDPVVALSWLHNGVKLALHVEKSGASNFGEKFSRVKFSPSLTLFGGKPMEGWIAVTISGLVTVSLLKPNGQVLTSTESLCRLRCRVALADVAFTGGGNIVVATSDGSSASPVQFYKVCVSVVNEKCKIDTEILPSLFMRCTTDPARKDKYPAITHLKFLARDMSEQVLLCASNQNNSIVECWSLRKEGLPVNNIFQQISPVGLALAFHDGSVHIVHRLSLQMMAVFHGSSSQRPVDEQTIKRQRTTGPLVHFKAMQLSWTSLALAGIDSHGKLSMLRISPSMGHVLDMNTSLRHLLFLLEYCMVTGYDWWDILLHVQPNMVQNLVEKLHEEYTRQSAALQQVLATRIVAMKASLCKLSSSTIARVCDYHAKLFLIAISCTLKSLLRPHFLNTPDKSPGDRLTEVCSKITDIDIDKVMINLKTEEFVLEMNTLQSLQQLIQWVGDFVLYLLASLPNQGSPVRPGHSFLRDGASLGMFRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWLCCREESHITEPDDTLIDECCLLPSQLLIPNIDWLPINDGIISKLQNKQLVRLQFGKAPGLIGHTVSSQFDAFVRAPGQPKIDHLRRLHLGAYPTEECKSCTRCGCVTMLKSPNKVTAVKQWEQRWVKNCLCGGLWRRMPLSYS
Length878
PositionTail
OrganismGallus gallus (Chicken)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae> Phasianinae> Gallus.
Aromaticity0.06
Grand average of hydropathy-0.081
Instability index53.02
Isoelectric point8.80
Molecular weight97061.45
Publications
PubMed=15592404

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364149
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09561
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.62|      16|      17|      95|     111|       1
---------------------------------------------------------------------------
   86-  102 (21.59/10.61)	PQPHRLHHRPAERgGAR
  103-  118 (34.03/14.59)	CGPPPFPPPPLTH.SPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     185.22|      42|     103|     465|     506|       2
---------------------------------------------------------------------------
  465-  503 (58.95/33.18)	...LVHF.KAMQ..LSWTS....LALAGI.DSHGK.....LSMLRISPSMGHVLD
  563-  602 (45.02/23.70)	...IVAM.KASL..CKLSS....STIARVcDYHAK.....LFLIAISCTLKSLLR
  606-  644 (55.56/30.87)	LNTPDKS.PGDR..LTEVC....SKITDI.DID.K.....V.MINLK.TEEFVLE
  645-  690 (25.69/10.54)	MNT....lQSLQqlIQWVGdfvlYLLASL.PNQGSpvrpgHSFLRDGASLG....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.22|      14|      17|     783|     798|       6
---------------------------------------------------------------------------
  783-  798 (21.77/19.71)	QLVrlQFGKAPGL..IGH
  803-  818 (22.45/12.92)	QFD..AFVRAPGQpkIDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.34|      12|      17|     736|     747|       9
---------------------------------------------------------------------------
  736-  747 (24.08/12.29)	CCREESHITEPD
  754-  765 (23.26/11.64)	CCLLPSQLLIPN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09561 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQIWRRRSGPPPGLSSAVPEGAAARREQPA
2) RLRSTPPPVPGSSDGFGVRVRVGEAAEERPLPAHPAGVRLVLPQPHRLHHRPAERGGARCGPPPFPPPPLTHSPRCSRGPSAFPLPPPRPANGAGVRL
1
44
30
141










Molecular Recognition Features






MoRF SequenceStartStop




1) MQIWRRRS
1
8