<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09559
| Description |
Mediator complex subunit 30 |
| Sequence | MSTPPLAGAGMPPGAFSGTQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPIPIEQLIPYVEEDGSKHDDRGAASQLRFASEERREIMEVNKKLKLKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 179 |
| Position | Head |
| Organism | Gallus gallus (Chicken) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.472 |
| Instability index | 41.17 |
| Isoelectric point | 8.46 |
| Molecular weight | 20413.30 |
| Publications | PubMed=15592404
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP09559
No repeats found
|